Flutterwire.com: Flagged as Suspicious – Analysis, Reviews, and Complaints

Flutterwire.com reviews. Is legit or a scam, can you trust Flutterwire.com? Date of last check: 2024-05-13

Visit website

Current Status of Flutterwire.com in Our Database: Low trust site

Our automated system has detected suspicious signs on the website Flutterwire.com, indicating potential untrustworthiness. Although these signs do not confirm malicious intent with 100% certainty, we strongly recommend exercising caution and thoroughly checking the site before interacting with it. The warning is based on an analysis of the website's behavior, content, and history. Stay vigilant to ensure online safety.

Review of website:

In our opinion, flutterwire.com - Low trust site, possibly a scam. We advise avoid that website. A site with a low level of trust on which you should not enter personal information or make purchases.

Message from Paranoid Web Extension plugin:

The site was created less than five days ago and is distributed through advertising. We consider this very suspicious. Be careful, you may want to mislead.

This website uses WordPress

We had not found links to social networks on the page

At the moment of detection, the website was created in less than 10 days ago

The website is not visited by many users

Protect Yourself and Your Family from dangerous websites

Install «Paranoid Web Extension» on IOS and it will block dangerous websites in the Safari Browser.

Users reactions to Flutterwire.com

You can make a complaint

Please make your reaction correctly. That helps us detect scams/dangerous websites quickly and make the internet safety.

0
Scam

Nobody complained

0
Suspicious

Nobody complained

0
Low quality service

Nobody complained

0
Report False Positiv

This website legit

You have successfully reacted. Your reaction will be counted soon.

Reactions is not available right now

Summary analysis Flutterwire.com

HTML page Analysis

We didn't find similarities with previously find scam websites or with popular websites. It does not guarantee that the website is legit. Scammers often mass-create websites and use the same design. That helps us to detect and block scam websites.

Flutterwire.com technical analysis

As of our latest detection, Flutterwire.com was found to be a newly created website, established less than 10 days ago. This is a significant red flag in our security assessment. It is a common pattern observed with most scam websites; they are often created and put into immediate use for fraudulent activities. Such a brief period between the website's creation and its activation raises concerns about its legitimacy. This is because scam operators typically set up new sites quickly to start their deceptive practices before they are detected and shut down. We advise users to exercise extreme caution and conduct thorough verification before interacting with Flutterwire.com, as its recent establishment may indicate potential risks.

Social analysis

We had not found links to social networks on the page Flutterwire.com. Social networks are an excellent way to connect with your customers, which is why all big web stores have links to their social profiles. That is why web stores without social profiles are suspicious.

Flutterwire.com is not visited by many users. For some, particular case, it is normal. For online shop is an important flag to make decision about interaction with this website.

When considering interacting with suspicious websites like flutterwire.com, be aware of the following potential risks:

Warning: There are reasons to believe that the website flutterwire.com may be suspicious and pose risks to users. Although these suspicions are not 100% confirmed, we recommend exercising increased caution when interacting with flutterwire.com for the following reasons:

Security threats: flutterwire.com exhibits signs that may indicate insufficient security measures compared to trusted websites. This potentially increases the risk of cyber attacks and data breaches, putting your personal and financial information at risk.

Fraud: Suspicious sites like flutterwire.com are sometimes used by scammers to create fake platforms aimed at stealing sensitive data or deceiving users into paying for non-existent goods or services.

Low quality: Given its limited history and reputation, flutterwire.com may struggle to consistently provide high-quality products or services, which could lead to customer disappointment and dissatisfaction.

Poor support: As a suspicious site, flutterwire.com risks failing to provide adequate and timely user support due to a lack of resources. This will complicate the resolution of potential issues.

Limited payment options: Like other suspicious sites, flutterwire.com may offer a small selection of payment methods, which is inconvenient for customers who prefer specific systems.

Considering these potential risks, we strongly advise conducting thorough research before using flutterwire.com or providing it with personal information. Look for reviews, assess its reputation, and be wary of red flags. If you have the slightest doubt about the safety and legitimacy of flutterwire.com, it is best to refrain from interacting with it.

Please note that this information is based on preliminary analysis and is not a final verdict. It is intended to encourage caution and vigilance when dealing with flutterwire.com and other suspicious websites. We recommend relying on authoritative sources and expert assessments to make the most informed decisions.

Website info

Detection url

flutterwire.com

Title

FlutterWire.com - Everything you need to know about Flutter in one place

Domain registration e-mail

abuse@ascio.com

Domain age

Current: 14 days

Domain registrar

Ascio Technologies, Inc. Danma..

Ssl issuer

Google Trust Services LLC

Whois renew date

2025-05-13

Whois registration date

2024-05-13

Description

The best Flutter resource to follow in 2024. Everything you need to know in one place: blogs, ui kits, themes, designs, tutorials, articles & ebooks by the Flutter community.

Server IP info

ip

104.21.70.54

Country

Name of organization

CLOUDFLARENET

Last checks website legit

Old Website
winterparkcycles.com
Dangerous Website
tronroom.biz
Dangerous Website
neveahoasis.com
Suspicious Website
aurreastore.com
Suspicious Website
getx-games8.ru
Suspicious Website
dsa.defiminingsd.com
Little known website
digivillfin.in
Suspicious Website
r7-online-cazino.ru
Little known website
mandarisi.tilda.ws
Old Website
wrenandwild.com
Little known website
ventusbikes.us
Potentially Legit Website
gvt1-cn.com
Little known website
3uch.ru
Little known website
dekinderhoek.nl
Suspicious Website
smallpdftool.com
Dangerous Website
apartmentrevampco.site
Suspicious Website
broadbandonne.com
Potentially Legit Website
mbags.ygshoes188.com
Dangerous Website
handymanservicesrepairman.life
Suspicious Website
betflix911.org
Suspicious Website
mkx6q6dkmbl.online
Suspicious Website
zx7ue1tydwl00.online
Suspicious Website
higota-fhx.com
Little known website
jdvastudesigns.com