Alert: Handymanservicesrepairman.life Labeled as Dangerous – Detailed Analysis, Reviews, and Concerns
Handymanservicesrepairman.life reviews. Is legit or a scam, can you trust Handymanservicesrepairman.life? Date of last check: 2024-04-29
Visit websiteCurrent Status of Handymanservicesrepairman.life in Our Database: Dangerous Website
Our automated system has classified Handymanservicesrepairman.life as a dangerous website. This categorization is based on specific patterns and attributes that align with known hazardous websites. It is possible that Handymanservicesrepairman.life has received complaints or exhibits striking resemblances to a website previously marked as dangerous. This assessment is a clear indication of potential risks associated with Handymanservicesrepairman.life. Users are strongly urged to exercise extreme caution when dealing with this website, as it is considered hazardous. Prioritizing safety is paramount, and conducting comprehensive due diligence is essential before engaging with Handymanservicesrepairman.life to mitigate the evident risks
Nothing to like
We had not found links to social networks on the page
At the moment of detection, the website was created in less than half a year ago
The website is not visited by many users
Users reactions to Handymanservicesrepairman.life
You can make a complaint
Please make your reaction correctly. That helps us detect scams/dangerous websites quickly and make the internet safety.
Summary analysis Handymanservicesrepairman.life
HTML page Analysis
We didn't find similarities with previously find scam websites or with popular websites. It does not guarantee that the website is legit. Scammers often mass-create websites and use the same design. That helps us to detect and block scam websites.
Handymanservicesrepairman.life technical analysis
At the moment of detection, Handymanservicesrepairman.life was created less than half a year ago. Most scam websites live less than one year. That's why you must be careful with young websites.
Social analysis
We had not found links to social networks on the page Handymanservicesrepairman.life. Social networks are an excellent way to connect with your customers, which is why all big web stores have links to their social profiles. That is why web stores without social profiles are suspicious.
Handymanservicesrepairman.life is not visited by many users. For some, particular case, it is normal. For online shop is an important flag to make decision about interaction with this website.
Attention: Potential Risks Associated with handymanservicesrepairman.life - Proceed with Extreme Caution
Attention: Based on our analysis, we strongly believe that the website handymanservicesrepairman.life should be treated as potentially dangerous, and interacting with it may expose users to significant risks. While our findings are based on available evidence, we recommend exercising extreme caution when considering any engagement with handymanservicesrepairman.life for the following reasons:
Suspicious activity: handymanservicesrepairman.life has been flagged by our system due to patterns and indicators that closely resemble those of websites known to engage in fraudulent or deceptive practices. These may include attempts to mislead users, distribute malware, or gather sensitive information under false pretenses. While not conclusive, this similarity warrants heightened vigilance.
Questionable reputation: Our research suggests that handymanservicesrepairman.life has a limited or questionable online reputation, with few credible user reviews or endorsements from trusted sources. This lack of established credibility raises concerns about the site's legitimacy and its ability to provide reliable, safe services or products to users.
Potential for financial losses: Engaging with handymanservicesrepairman.life may expose users to financial risks, such as fraudulent transactions, unauthorized charges, or purchases of counterfeit or inferior goods. The site's suspicious nature increases the likelihood of falling victim to scams designed to extract money or sensitive financial information from unsuspecting users.
Inadequate user protection: handymanservicesrepairman.life's suspicious status suggests that it may lack adequate measures to protect user privacy, secure personal data, or provide reliable customer support. This could leave users vulnerable to data breaches, identity theft, or unresolved disputes without proper recourse or assistance.
In light of these risks, we advise users to exercise extreme caution and avoid interacting with handymanservicesrepairman.life unless and until its legitimacy can be thoroughly verified. Refrain from providing any sensitive personal or financial information to the site, and be cautious about clicking on links or downloading files from handymanservicesrepairman.life. If you have any existing association with the site, consider taking steps to protect your information and monitor for any suspicious activity.
Please note that while our analysis is based on available data and indicators, it is not a definitive verdict on handymanservicesrepairman.life's status. There is a possibility that our assessment may be inaccurate or that the site's behavior may change over time. We encourage users to rely on multiple trusted sources, stay informed about online security risks, and make decisions based on their own careful evaluation of the available information.
Website info
Detection url
handymanservicesrepairman.life
Title
general contractor for water damage
Domain registration e-mail
abuse@godaddy.com
Domain age
Current: 190 days
Domain registrar
GoDaddy.com, LLC
Ssl issuer
Google Trust Services LLC
Whois renew date
2024-12-05
Whois registration date
2023-12-05
Domain registration country
US
Description
general contractor for water damage,ac handyman,window installation companies,garage repairman near me,garage door service near me,local gutter companies,bathtub installation near me,hvac installers,water heater plumbing,water heater replacement near me
Server IP info
ip
172.67.205.249
Country
US
Name of organization